PNKP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6693S
Artikelname: PNKP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6693S
Hersteller Artikelnummer: CNA6693S
Alternativnummer: MBL-CNA6693S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human PNKP (NP_009185.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 57kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RTVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLF
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human PNKP (NP_009185.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100