PUF60 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6709S
Artikelname: PUF60 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6709S
Hersteller Artikelnummer: CNA6709S
Alternativnummer: MBL-CNA6709S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 243-542 of human PUF60 (NP_055096.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 60kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 243-542 of human PUF60 (NP_055096.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:20 - 1:50