SECISBP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6736P
Artikelname: SECISBP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6736P
Hersteller Artikelnummer: CNA6736P
Alternativnummer: MBL-CNA6736P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 585-854 of human SECISBP2 (NP_076982.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 95kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: DELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLEL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 585-854 of human SECISBP2 (NP_076982.3).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200