TPPP3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6775P
Artikelname: TPPP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6775P
Hersteller Artikelnummer: CNA6775P
Alternativnummer: MBL-CNA6775P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057224.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 19kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057224.2).
Application Verdünnung: WB: WB,1:500 - 1:1000