DCAF7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6787P
Artikelname: DCAF7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6787P
Hersteller Artikelnummer: CNA6787P
Alternativnummer: MBL-CNA6787P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human DCAF7 (NP_005819.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 39kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human DCAF7 (NP_005819.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200