ZDHHC17 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6793S
Artikelname: ZDHHC17 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6793S
Hersteller Artikelnummer: CNA6793S
Alternativnummer: MBL-CNA6793S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZDHHC17 (NP_056151.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 73kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TSIVAYLIAKGQDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLEAGANVDAQNIKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKEFRQKVMLGTP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 170-310 of human ZDHHC17 (NP_056151.2).
Application Verdünnung: WB: WB,1:500 - 1:1000