DGAT1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6857S
Artikelname: DGAT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6857S
Hersteller Artikelnummer: CNA6857S
Alternativnummer: MBL-CNA6857S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human DGAT1 (NP_036211.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 55kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human DGAT1 (NP_036211.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200