DGKA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6896S1
Artikelname: DGKA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6896S1
Hersteller Artikelnummer: CNA6896S1
Alternativnummer: MBL-CNA6896S1
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
Puffer: PBS with 0.09% Sodium azide,50% glycerol
Quelle: Rabbit
Sequenz: MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human DGKA (NP_958852.1).
Application Verdünnung: WB: WB,1:100 - 1:500