TGM5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7039S
Artikelname: TGM5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7039S
Hersteller Artikelnummer: CNA7039S
Alternativnummer: MBL-CNA7039S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 461-720 of human TGM5 (NP_963925.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 81kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LQKLKARSFHGSQRGAELQPSRPTSLSQDSPRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIITLSYPSITINVLGAAVVNQPLSIQVIFSNPLSEQVEDCVLTVEGSGLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANMRSNKFKDIKGYRNV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 461-720 of human TGM5 (NP_963925.2).
Application Verdünnung: WB: WB,1:2000 - 1:8000|IHC-P,1:50 - 1:200