C16orf80 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7099P
Artikelname: C16orf80 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7099P
Hersteller Artikelnummer: CNA7099P
Alternativnummer: MBL-CNA7099P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 94-193 of human C16orf80 (NP_037374.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 23kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 94-193 of human C16orf80 (NP_037374.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:100