REST/NRSF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7161T
Artikelname: REST/NRSF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7161T
Hersteller Artikelnummer: CNA7161T
Alternativnummer: MBL-CNA7161T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human REST/NRSF (NP_005603.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 122kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 25-130 of human REST/NRSF (NP_005603.3).
Application Verdünnung: WB: WB,1:100 - 1:500