HDAC5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7189S
Artikelname: HDAC5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7189S
Hersteller Artikelnummer: CNA7189S
Alternativnummer: MBL-CNA7189S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC5 (NP_005465.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 122kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RALPLDSSPNQFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HDAC5 (NP_005465.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:20 - 1:50