IDH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7190P
Artikelname: IDH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7190P
Hersteller Artikelnummer: CNA7190P
Alternativnummer: MBL-CNA7190P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 193-452 of human IDH2 (NP_002159.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 51kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 193-452 of human IDH2 (NP_002159.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:20 - 1:50|IP,1:50 - 1:200|ChIP,1:20 - 1:100