TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7224S
Artikelname: TP53AIP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7224S
Hersteller Artikelnummer: CNA7224S
Alternativnummer: MBL-CNA7224S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-108 of human TP53AIP1 (NP_001238893.1).
Application Verdünnung: WB: WB,1:500 - 1:2000