CD47 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7278P
Artikelname: CD47 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7278P
Hersteller Artikelnummer: CNA7278P
Alternativnummer: MBL-CNA7278P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (NP_001768.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 35kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HYYVFSTAIGLTSFVIAILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQPPRKAVEEPLNAFKESKGMMNDE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 224-323 of human CD47 (NP_001768.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200