DCD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7280S
Artikelname: DCD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7280S
Hersteller Artikelnummer: CNA7280S
Alternativnummer: MBL-CNA7280S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: YDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human DCD (NP_444513.1).
Application Verdünnung: WB: WB,1:2000 - 1:9000