Ku70 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7330S
Artikelname: Ku70 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7330S
Hersteller Artikelnummer: CNA7330S
Alternativnummer: MBL-CNA7330S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Ku70 (NP_001460.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 70kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human Ku70 (NP_001460.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|IF/ICC,1:50 - 1:100|IP,1:20 - 1:50