ATG10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7390T
Artikelname: ATG10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7390T
Hersteller Artikelnummer: CNA7390T
Alternativnummer: MBL-CNA7390T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 160 to the C-terminus of human ATG10 (NP_113670.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 25kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: FFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 160 to the C-terminus of human ATG10 (NP_113670.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200