ATG9B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7406P
Artikelname: ATG9B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7406P
Hersteller Artikelnummer: CNA7406P
Alternativnummer: MBL-CNA7406P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 715-924 of human ATG9B (NP_775952.4).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 101kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: HPLWRPPGHSSKFLGHLWGRVQQDAAAWGATSARGPSTPGVLSNCTSPLPEAFLANLFVHPLLPPRDLSPTAPCPAAATASLLASISRIAQDPSSVSPGGTGGQKLAQLPELASAEMSLHVIYLHQLHQQQQQQEPWGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKARNLFPGGFQVTTDTQKEPDRASCTD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 715-924 of human ATG9B (NP_775952.4).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200