[KO Validated] CD34 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7429S
Artikelname: [KO Validated] CD34 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7429S
Hersteller Artikelnummer: CNA7429S
Alternativnummer: MBL-CNA7429S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-320 of human CD34 (NP_001020280).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 41kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 160-320 of human CD34 (NP_001020280).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200