PCGF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7459S
Artikelname: PCGF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7459S
Hersteller Artikelnummer: CNA7459S
Alternativnummer: MBL-CNA7459S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-242 of human PCGF3 (NP_006306.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 28kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-242 of human PCGF3 (NP_006306.2).
Application Verdünnung: WB: WB,1:500 - 1:2000