LSM11 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7516S
Artikelname: LSM11 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7516S
Hersteller Artikelnummer: CNA7516S
Alternativnummer: MBL-CNA7516S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 131-360 of human LSM11 (NP_775762.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 40kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RRGPGRSRKAPRNVLTRMPLHEGSPLGELHRCIREGVKVNVHIRTFKGLRGVCTGFLVAFDKFWNMALTDVDETYRKPVLGKAYERDSSLTLTRLFDRLKLQDSSKKEADSKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRSVPSSLQASAREESRSELSGRTTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLVHLAQ
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 131-360 of human LSM11 (NP_775762.1).
Application Verdünnung: WB: WB,1:500 - 1:2000