EIF4G1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7552S
Artikelname: EIF4G1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7552S
Hersteller Artikelnummer: CNA7552S
Alternativnummer: MBL-CNA7552S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 175kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: PEELLNGAPSPPAVDLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGEAESEKGGEELLPPESTPIPANLSQNLE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human EIF4G1 (NP_886553.3).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IP,1:100 - 1:500