C1GALT1C1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7590S
Artikelname: C1GALT1C1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7590S
Hersteller Artikelnummer: CNA7590S
Alternativnummer: MBL-CNA7590S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 36kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 30-190 of human C1GALT1C1 (NP_689905.1).
Application Verdünnung: WB: WB,1:500 - 1:2000