Desmoplakin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7635S
Artikelname: Desmoplakin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7635S
Hersteller Artikelnummer: CNA7635S
Alternativnummer: MBL-CNA7635S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Desmoplakin (NP_004406.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 332kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Desmoplakin (NP_004406.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200