Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Thioredoxin 1 (Trx1/TXN) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: MBL-CNA7638S
• Hersteller Artikelnummer: CNA7638S
• Alternativnummer: MBL-CNA7638S
• Hersteller: MBL
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ICC, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 12kDa
• Puffer: PBS with 0.02% sodium azide,50% glycerol
• Quelle: Rabbit
• Reinheit: Affinity purification
• Formulierung: PBS with 0.02% sodium azide,50% glycerol
• Sequenz: DKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
• Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 20 to the C-terminus of human Thioredoxin 1 (Trx1/Thioredoxin 1 (Trx1/TXN)) (NP_003320.2).

Anwendungsbeschreibung

• Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:20 - 1:50