C4BPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7648P
Artikelname: C4BPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7648P
Hersteller Artikelnummer: CNA7648P
Alternativnummer: MBL-CNA7648P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 67kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human C4BPA (NP_000706.1).
Application Verdünnung: WB: WB,1:1000 - 1:5000