GYPB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7682T
Artikelname: GYPB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7682T
Hersteller Artikelnummer: CNA7682T
Alternativnummer: MBL-CNA7682T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 10kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYTIRRLIKA
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-91 of human GYPB (NP_002091.3).
Application Verdünnung: WB: WB,1:500 - 1:2000