ITGA9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7693S
Artikelname: ITGA9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7693S
Hersteller Artikelnummer: CNA7693S
Alternativnummer: MBL-CNA7693S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-250 of human ITGA9 (NP_002198.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 114kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: YNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIMNRRYTYLGYA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 30-250 of human ITGA9 (NP_002198.2).
Application Verdünnung: WB: WB,1:500 - 1:2000