Proprotein Convertase 9(PCSK9) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7860P
Artikelname: Proprotein Convertase 9(PCSK9) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7860P
Hersteller Artikelnummer: CNA7860P
Alternativnummer: MBL-CNA7860P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 74kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200