[KO Validated] CHD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7883S
Artikelname: [KO Validated] CHD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7883S
Hersteller Artikelnummer: CNA7883S
Alternativnummer: MBL-CNA7883S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 197kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:100 - 1:200