STX1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA7931S
Artikelname: STX1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA7931S
Hersteller Artikelnummer: CNA7931S
Alternativnummer: MBL-CNA7931S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STX1A (Q16623).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STX1A (Q16623).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200