GRID1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8011S
Artikelname: GRID1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8011S
Hersteller Artikelnummer: CNA8011S
Alternativnummer: MBL-CNA8011S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 112kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MNSLMDEDIAHKQISPASIELSALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSATMPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 880-1009 of human GRID1 (NP_060021.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200