KDM7A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8266P
Artikelname: KDM7A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8266P
Hersteller Artikelnummer: CNA8266P
Alternativnummer: MBL-CNA8266P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 417-735 of mouse KDM7A (NP_001028602.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 92kDa/106kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: LKEDGFQPQSYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPSVCPVSRPSNEASPPYHSRRKMRKLRDHNVRTPSNLDILELHTREVLKRLEMCPWEEDLLSSKLNGKFNKHLQPSSTVPEWRAKDNDLRLLLTNGRIIKDERQLFADRSLYTADSENEEDKKPTQNANMKTEQSSGREEAESQGSPKPLNRIFTSVRSELRSRPSEYSDGSDSEDSGPDCT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 417-735 of mouse KDM7A (NP_001028602.2).
Application Verdünnung: WB: WB,1:500 - 1:2000