UAP56/DDX39B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8356S
Artikelname: UAP56/DDX39B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8356S
Hersteller Artikelnummer: CNA8356S
Alternativnummer: MBL-CNA8356S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human UAP56/UAP56/DDX39B (NP_004631.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 49kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human UAP56/UAP56/DDX39B (NP_004631.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200