GHRHR Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8421S
Artikelname: GHRHR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8421S
Hersteller Artikelnummer: CNA8421S
Alternativnummer: MBL-CNA8421S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 47kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MDRRMWGAHVFCVLSPLPTVLGHMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGLLCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEESYFSTVK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human GHRHR (NP_000814.2).
Application Verdünnung: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200