SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8452T
Artikelname: SLCO1A2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8452T
Hersteller Artikelnummer: CNA8452T
Alternativnummer: MBL-CNA8452T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 606-670 of human SLCO1A2 (NP_602307.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 74kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 606-670 of human SLCO1A2 (NP_602307.1).
Application Verdünnung: WB: WB,1:1000 - 1:5000