GAS6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8545S
Artikelname: GAS6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8545S
Hersteller Artikelnummer: CNA8545S
Alternativnummer: MBL-CNA8545S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human GAS6 (NP_000811.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 75kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GSPYTKNSGFATCVQNLPDQCTPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVDECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 100-300 of human GAS6 (NP_000811.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100