GLP1R Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8547S
Artikelname: GLP1R Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8547S
Hersteller Artikelnummer: CNA8547S
Alternativnummer: MBL-CNA8547S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 53kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: GPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 22-116 of human GLP1R (NP_002053.3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200