GATC Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA8604S
Artikelname: GATC Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA8604S
Hersteller Artikelnummer: CNA8604S
Alternativnummer: MBL-CNA8604S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human GATC (NP_789788.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 15kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human GATC (NP_789788.1).
Application Verdünnung: WB: WB,1:500 - 1:2000