IKZF3 Rabbit mAb, Clone: [ARC2781], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8614S
Artikelname: IKZF3 Rabbit mAb, Clone: [ARC2781], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8614S
Hersteller Artikelnummer: CNA8614S
Alternativnummer: MBL-CNA8614S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2781]
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: IYQQNHMVLSRARNGMPLLKEVPRSYELLKPPPICPRDSVKVINKEGEVMDVYRCDHCRVLFLDYVMFTIHMGCHGFRDPFECNMCGYRSHDRYEFSSHIARGEHRALLK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 400-509 of human IKZF3 (Q9UKT9).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500