PEN2/PSENEN Rabbit mAb, Clone: [ARC1779], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8678S
Artikelname: PEN2/PSENEN Rabbit mAb, Clone: [ARC1779], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8678S
Hersteller Artikelnummer: CNA8678S
Alternativnummer: MBL-CNA8678S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PEN2/PSENEN (Q9NZ42).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1779]
Molekulargewicht: 12kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTSWITIFQIYRPRWGALGDYLSFTIPLGTP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human PEN2/PSENEN (Q9NZ42).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200