NDUFS4 Rabbit mAb, Clone: [ARC1784], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8691S
Artikelname: NDUFS4 Rabbit mAb, Clone: [ARC1784], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8691S
Hersteller Artikelnummer: CNA8691S
Alternativnummer: MBL-CNA8691S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NDUFS4 (O43181).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1784]
Molekulargewicht: 20kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSTWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKME
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human NDUFS4 (O43181).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200