Calpain 1 Rabbit mAb, Clone: [ARC1272], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8710S
Artikelname: Calpain 1 Rabbit mAb, Clone: [ARC1272], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8710S
Hersteller Artikelnummer: CNA8710S
Alternativnummer: MBL-CNA8710S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1272]
Molekulargewicht: 82kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: DGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNG
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Calpain 1 (P07384).
Application Verdünnung: WB: WB,1:500 -1:1000|IF/ICC,1:50 -1:200