PRKRA/PACT Rabbit mAb, Clone: [ARC1299], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8779S
Artikelname: PRKRA/PACT Rabbit mAb, Clone: [ARC1299], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8779S
Hersteller Artikelnummer: CNA8779S
Alternativnummer: MBL-CNA8779S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1299]
Molekulargewicht: 34kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: TWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAHNALQYLKIIAERK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 214-313 of human PRKRA/PACT (O75569).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200