Complement factor H Rabbit mAb, Clone: [ARC1306], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8798S
Artikelname: Complement factor H Rabbit mAb, Clone: [ARC1306], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8798S
Hersteller Artikelnummer: CNA8798S
Alternativnummer: MBL-CNA8798S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Complement factor H (P08603).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1306]
Molekulargewicht: 139kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Complement factor H (P08603).
Application Verdünnung: WB: WB,1:500 - 1:1000