Endo G Rabbit mAb, Clone: [ARC1308], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8801S
Artikelname: Endo G Rabbit mAb, Clone: [ARC1308], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8801S
Hersteller Artikelnummer: CNA8801S
Alternativnummer: MBL-CNA8801S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 198-297 of human Endo G (Q14249).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1308]
Molekulargewicht: 33kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGGQIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 198-297 of human Endo G (Q14249).
Application Verdünnung: WB: WB,1:500 - 1:1000