GNAI1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA8844T
| Artikelname: |
GNAI1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA8844T |
| Hersteller Artikelnummer: |
CNA8844T |
| Alternativnummer: |
MBL-CNA8844T |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GNAI1 (NP_002060.4). |
| Konjugation: |
Unconjugated |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
40kDa |
| Puffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequenz: |
VKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLND |
| Target-Kategorie: |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human GNAI1 (NP_002060.4). |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
