PLC gamma 1 (PLCG1) Rabbit mAb, Clone: [ARC1345], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8899S
Artikelname: PLC gamma 1 (PLCG1) Rabbit mAb, Clone: [ARC1345], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8899S
Hersteller Artikelnummer: CNA8899S
Alternativnummer: MBL-CNA8899S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 710-832 of human PLC gamma 1 (PLC gamma 1 (PLCG1)) (P19174).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1345]
Molekulargewicht: 149kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: GKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGD
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 710-832 of human PLC gamma 1 (PLC gamma 1 (PLCG1)) (P19174).
Application Verdünnung: WB: WB,1:500 - 1:1000