LTA4H Rabbit mAb, Clone: [ARC1351], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA8918S
Artikelname: LTA4H Rabbit mAb, Clone: [ARC1351], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA8918S
Hersteller Artikelnummer: CNA8918S
Alternativnummer: MBL-CNA8918S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1351]
Molekulargewicht: 69kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 501-600 of human LTA4H (P09960).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200